Recombinant Vibrio parahaemolyticus serotype O3:K6 Outer membrane protein ompK (ompK) | CSB-EP349512VFE

Recombinant Vibrio parahaemolyticus serotype O3:K6 Outer membrane protein ompK (ompK) | CSB-EP349512VFE | Cusabio

Alternative Name(s): ompK; OMPK_VIBPA; Outer membrane protein ompK

Gene Names: ompK

Research Areas: Others

Organism: Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

AA Sequence: ADYSDGDIHKNDYKWMQFNLMGAFDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLASDKGSDKVGDPKIFMKFAPRMSIDGLTGKDLSFGPVQELYVATLFEWDGTDYKTNPFSVNNQKVGIGSDVMVPWFGKVGVNLYGTYQGNQKDWNGFQISTNWFKPFYFFENGSFISYQGYIDYQFGMKEKYSSASNGGAMFNGIYWHSDRFAVGYGLKGYKDVYGIKDSDALKSTGFGHYVAVTYKF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-266aa

Sequence Info: Full Length of Mature Protein

MW: 43.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Serves as receptor for a broad-host-range vibriophage, KVP40.

Reference: "Genome sequence of Vibrio parahaemolyticus: a pathogenic mechanism distinct from that of V. cholerae."Makino K., Oshima K., Kurokawa K., Yokoyama K., Uda T., Tagomori K., Iijima Y., Najima M., Nakano M., Yamashita A., Kubota Y., Kimura S., Yasunaga T., Honda T., Shinagawa H., Hattori M., Iida T.Lancet 361:743-749(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Serves as receptor for a broad-host-range vibriophage, KVP40.

Involvement in disease:

Subcellular Location: Cell outer membrane

Protein Families: Nucleoside-specific channel-forming outer membrane porin (Tsx) (TC 1.B.10) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P59570

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A