Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB) | CSB-EP360704VEX

(No reviews yet) Write a Review
SKU:
CSB-EP360704VEX
Availability:
13 - 23 Working Days
  • Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Vibrio cholerae serotype O1 Cholera enterotoxin subunit B (ctxB) | CSB-EP360704VEX | Cusabio

Alternative Name(s): Cholera enterotoxin B chain Cholera enterotoxin gamma chain Choleragenoid

Gene Names: ctxB

Research Areas: Microbiology

Organism: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

AA Sequence: TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-124aa

Sequence Info: Full Length of Mature Protein

MW: 15.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.

Reference: "Nucleotide sequence analysis of the A2 and B subunits of Vibrio cholerae enterotoxin." Lockman H., Kaper J.B. J. Biol. Chem. 258:13722-13726(1983)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The B subunit pentameric ring directs the A subunit to its target by binding to the GM1 gangliosides present on the surface of the intestinal epithelial cells. It can bind five GM1 gangliosides. It has no toxic activity by itself.

Involvement in disease:

Subcellular Location: Secreted, Host cell membrane

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01556

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose