Cusabio Virus & Bacteria Recombinants
Recombinant Vespa magnifica Hyaluronidase | CSB-EP308534VBQ
- SKU:
- CSB-EP308534VBQ
- Availability:
- 3 - 7 Working Days
Description
Recombinant Vespa magnifica Hyaluronidase | CSB-EP308534VBQ | Cusabio
Alternative Name(s): Hyaluronoglucosaminidase (Vesp ma 2) (Hya)
Gene Names: N/A
Research Areas: Others
Organism: Vespa magnifica (Hornet)
AA Sequence: SERPKRVFNIYWNVPTFMCHQYGLYFDEVTNFNIKHNSKDNFQGDKIAIFYDPGEFPALLPLNYGKYKIRNGGVPQEGNITIHLQRFIEYLDKTYPNRNFSGIGVIDFERWRPIFRQNWGNMKIYKNFSIDLVRKEHPFWNKKMIELEASKRFEKYARLFMEETLKLAKKTRKQADWGYYGYPYCFNMSPTNFVPDCDVTARDENNEMSWLFNNQNVLLPSVYIRRELTPDQRIGLVQGRVKEAVRISNKLKHSPKVFSYWWYVYQDETNTFLTETDVKKTFQEIVINGGDGIIIWGSSSDVNSLSKCTRLREYLLTVLGPIAVNVTEAVN
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 27-357aa
Sequence Info: Full Length of Mature Protein
MW: 45.1 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Hydrolyzes high molecular weight hyaluronic acid to produce small oligosaccharides.
Reference: "Purification and characterization of two new allergens from the venom of Vespa magnifica." An S., Chen L., Wei J.F., Yang X., Ma D., Xu X., Xu X., He S., Lu J., Lai R. PLoS ONE 7:E31920-E31920(2012)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P86875
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A