Recombinant Vesicular stomatitis Indiana virus Protein C' (P) | CSB-EP768100VBH

Recombinant Vesicular stomatitis Indiana virus Protein C' (P) | CSB-EP768100VBH | Cusabio

Alternative Name(s): PProtein C'

Gene Names: p

Research Areas: Others

Organism: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)

AA Sequence: MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKACMYQIRKLSKLKALYRGL

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-67aa

Sequence Info: Full Length

MW: 11.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May play a role in viral pathogenesis or transmission by insects vectors.

Reference: "Cloning and expression of a viral phosphoprotein: structure suggests vesicular stomatitis virus NS may function by mimicking an RNA template." Hudson L.D., Condra C., Lazzarini R.A. J. Gen. Virol. 67:1571-1579(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in viral pathogenesis or transmission by insects vectors.

Involvement in disease:

Subcellular Location:

Protein Families: Rhabdoviruses C protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q86132

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A