Recombinant Variola virus 14 kDa fusion protein (A27L) | CSB-YP335866VARb0

(No reviews yet) Write a Review
SKU:
CSB-YP335866VARb0
Availability:
25 - 35 Working Days
  • Recombinant Variola virus 14 kDa fusion protein (A27L)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,076.00

Description

Recombinant Variola virus 14 kDa fusion protein (A27L) | CSB-YP335866VARb0 | Cusabio

Alternative Name(s): A27L; A30L14 kDa fusion protein

Gene Names: A27L

Research Areas: Others

Organism: Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)

AA Sequence: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-110aa

Sequence Info: Full length

MW: 15.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion

Reference: "Creation of a clone library of fragments from the natural variola virus and study of the structural and functional organization of viral genes from a circle of hosts." Shchelkunov S.N., Marennikova S.S., Totmenin A.V., Blinov V.M., Chizhikov V.E., Gutorov V.V., Safronov P.F., Pozdnyakov S.G., Shelukhina E.M., Gashnikov P.V., Anjaparidze O.G., Sandakhchiev L.S. Dokl. Akad. Nauk SSSR 321:402-406(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity).

Involvement in disease:

Subcellular Location: Virion

Protein Families: Chordopoxvirinae A27 protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P33816

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose