Recombinant Vaejovis mexicanus smithi Potassium channel toxin alpha-KTx 21.1 | CSB-MP317987VAK

Recombinant Vaejovis mexicanus smithi Potassium channel toxin alpha-KTx 21.1 | CSB-MP317987VAK | Cusabio

Alternative Name(s): Toxin Vm24 Toxin alpha-KTx 21.1

Gene Names: N/A

Research Areas: Others

Organism: Vaejovis mexicanus smithi (Scorpion) (Vaejovis smithi)

AA Sequence: AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-36aa

Sequence Info: Full Length

MW: 7.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 µg) produce no symptoms of intoxication when injected into mice.

Reference: "Structure, function, and chemical synthesis of vaejovis mexicanus peptide 24: a novel potent blocker of Kv1.3 potassium channels of human T lymphocytes." Gurrola G.B., Hernandez-Lopez R.A., Rodriguez de la Vega R.C., Varga Z., Batista C.V.F., Salas-Castillo S.P., Panyi G., del Rio-Portilla F., Possani L.D. Biochemistry 51:4049-4061(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Selectively and irreversibly binds (K(d)=2.9 pM) and blocks hKv1.3/KCNA3 potassium channels of human T-lymphocytes. Weakly blocks hKCa3.1/KCNN4, mKv1.1/KCNA1, and hKv1.2/KCNA2 channels. In vivo, high doses (200 ug) produce no symptoms of intoxication when injected into mice.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Short scorpion toxin superfamily, Potassium channel inhibitor family, Alpha-KTx 23 subfamily

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0DJ31

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A