Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR) | CSB-EP335028VAF

(No reviews yet) Write a Review
SKU:
CSB-EP335028VAF
Availability:
3 - 7 Working Days
  • Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $1,053.60

Description

Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR) | CSB-EP335028VAF | Cusabio

Alternative Name(s): Protein B5

Gene Names: PS/HR

Research Areas: Others

Organism: Vaccinia virus (strain LC16m8) (VACV)

AA Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 18-92aa

Sequence Info: Full Length of Mature Protein

MW: 14.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.

Reference: "Regulation of plaque size and host range by a vaccinia virus gene related to complement system proteins." Takahashi-Nishimaki F., Funahashi S., Miki K., Hashizume S., Sugimoto M. Virology 181:158-164(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Regulation of plaque size and host range. In this strain the truncated ps/hr protein is probably not functional.

Involvement in disease:

Subcellular Location:

Protein Families: Receptors of complement activation (RCA) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P24284

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose