Recombinant Vaccinia virus Protein B5 (PS/HR), partial | CSB-EP312446VAI

(No reviews yet) Write a Review
SKU:
CSB-EP312446VAI
Availability:
3 - 7 Working Days
$422.40 - $687.60

Description

Recombinant Vaccinia virus Protein B5 (PS/HR), partial | CSB-EP312446VAI | Cusabio

Alternative Name(s): Protein B5

Gene Names: PS/HR

Research Areas: Others

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

AA Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 18-279aa

Sequence Info: Partial

MW: 33.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions to allow virion entry into host cells. Participates also in wrapping mature virions to form enveloped virions.

Reference: "Acidic residues in the membrane-proximal stalk region of vaccinia virus protein B5 are required for glycosaminoglycan-mediated disruption of the extracellular enveloped virus outer membrane." Roberts K.L., Breiman A., Carter G.C., Ewles H.A., Hollinshead M., Law M., Smith G.L. J. Gen. Virol. 90:1582-1591(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions (EV) to allow virion entry into host cells. Participates also in wrapping mature virions (MV) to form enveloped virions (EV).

Involvement in disease:

Subcellular Location: Virion membrane, Single-pass type I membrane protein, Virion

Protein Families: Receptors of complement activation (RCA) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q01227

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose