Recombinant Vaccinia virus Protein B5 (PS/HR), partial | CSB-BP321891VAA1

(No reviews yet) Write a Review
SKU:
CSB-BP321891VAA1
Availability:
3 - 7 Working Days
  • Recombinant Vaccinia virus Protein B5 (PS/HR), partial
  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP321891VAA1 could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain Copenhagen) (VACV) PS/HR.
€443.00 - €1,060.00

Description

Recombinant Vaccinia virus Protein B5 (PS/HR), partial | CSB-BP321891VAA1 | Cusabio

Alternative Name(s): Plaque-size/host range protein

Gene Names: PS/HR

Research Areas: Others

Organism: Vaccinia virus (strain Copenhagen) (VACV)

AA Sequence: YSTCTVPTMNNAKLTSTETSFNNNQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 18-279aa

Sequence Info: Partial

MW: 33.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays a role in the dissolution of the outermost membrane of extracellular enveloped virions to allow virion entry into host cells. Participates also in wrapping intracellular mature virions to form intracellular enveloped virions.

Reference: "The complete DNA sequence of vaccinia virus." Goebel S.J., Johnson G.P., Perkus M.E., Davis S.W., Winslow J.P., Paoletti E. Virology 179:247-266(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21115

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose