Cusabio Vaccinia virus Recombinants
Recombinant Vaccinia virus Protein A27 (VACWR150) | CSB-EP318120VAI
- SKU:
- CSB-EP318120VAI
- Availability:
- 3 - 7 Working Days
Description
Recombinant Vaccinia virus Protein A27 (VACWR150) | CSB-EP318120VAI | Cusabio
Alternative Name(s): /
Gene Names: VACWR150
Research Areas: others
Organism: Vaccinia virus(strain Western Reserve)(VACV)(Vaccinia virus(strain WR))
AA Sequence: MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-110aa
Sequence Info: Full Length
MW: 17.6 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion.
Reference: "The vaccinia virus A27L protein is needed for the microtubule-dependent transport of intracellular mature virus particles." Sanderson C.M., Hollinshead M., Smith G.L. J. Gen. Virol. 81:47-58(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P11258
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A