Cusabio Vaccinia virus Recombinants
Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR), partial | CSB-YP328444VAG
- SKU:
- CSB-YP328444VAG
- Availability:
- 25 - 35 Working Days
Description
Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR), partial | CSB-YP328444VAG | Cusabio
Alternative Name(s): Protein B5
Gene Names: PS/HR
Research Areas: Others
Organism: Vaccinia virus (strain Lister) (VACV)
AA Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYITINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 18-279aa
Sequence Info: Partial
MW: 31.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Regulation of plaque size and host range.
Reference: "Regulation of plaque size and host range by a vaccinia virus gene related to complement system proteins." Takahashi-Nishimaki F., Funahashi S., Miki K., Hashizume S., Sugimoto M. Virology 181:158-164(1991)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Regulation of plaque size and host range.
Involvement in disease:
Subcellular Location: Membrane, Single-pass type I membrane protein
Protein Families: Receptors of complement activation (RCA) family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P24083
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A