Recombinant Vaccinia virus 14 kDa fusion protein (A27L) | CSB-BP324948VAA

(No reviews yet) Write a Review
SKU:
CSB-BP324948VAA
Availability:
3 - 7 Working Days
  • Recombinant Vaccinia virus 14 kDa fusion protein (A27L)
  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP324948VAA could indicate that this peptide derived from Baculovirus-expressed Vaccinia virus (strain Copenhagen) (VACV) A27L.
£354.40 - £848.00

Description

Recombinant Vaccinia virus 14 kDa fusion protein (A27L) | CSB-BP324948VAA | Cusabio

Alternative Name(s): A27L14 kDa fusion protein

Gene Names: A27L

Research Areas: Others

Organism: Vaccinia virus (strain Copenhagen) (VACV)

AA Sequence: MDGTLFPGDDDLAIPATEFFSTKADKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-110aa

Sequence Info: Full Length

MW: 16.6

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Structural protein involved in the envelopment of mature virion to form the wrapped virion. The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion movement within the infected cell. May play an indirect role in MV-cell fusion.

Reference: "Appendix to 'The complete DNA sequence of vaccinia virus'." Goebel S.J., Johnson G.P., Perkus M.E., Davis S.W., Winslow J.P., Paoletti E. Virology 179:517-563(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20535

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose