Recombinant Tuber borchii Cyanovirin-N homolog | CSB-EP692568TJE

(No reviews yet) Write a Review
SKU:
CSB-EP692568TJE
Availability:
13 - 23 Working Days
  • Recombinant Tuber borchii Cyanovirin-N homolog
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Tuber borchii Cyanovirin-N homolog | CSB-EP692568TJE | Cusabio

Alternative Name(s): Cyanovirin-N homolog; CV-N homolog

Gene Names: N/A

Research Areas: Others

Organism: Tuber borchii (White truffle)

AA Sequence: MSYADSSRNAVLTNGGRTLRAECRNADGNWVTSELDLDTCIGNPNGFLGWGMQNFSHSSEDIKLEEGGRKLTCRPKTVDGGFRERQGIDLNRIQNVNGRLVFQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-103aa

Sequence Info: Full Length

MW: 15.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Mannose-binding lectin.

Reference: "Gene expression profiling of the nitrogen starvation stress response in the mycorrhizal ascomycete Tuber borchii." Montanini B., Gabella S., Abba S., Peter M., Kohler A., Bonfante P., Chalot M., Martin F., Ottonello S. Fungal Genet. Biol. 43:630-641(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Mannose-binding lectin.

Involvement in disease:

Subcellular Location:

Protein Families: Cyanovirin-N family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5MK11

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose