Recombinant Trypanosoma cruzi Kinetoplastid membrane protein 11 (KMP-11) | CSB-EP880045TQY

Recombinant Trypanosoma cruzi Kinetoplastid membrane protein 11 (KMP-11) | CSB-EP880045TQY | Cusabio

Alternative Name(s): KMP11

Gene Names: KMP-11

Research Areas: Microbiology

Organism: Trypanosoma cruzi

AA Sequence: MATTLEEFSAKLDRLDAEFAKKMEEQNKKFFADKPDESTLSPEMKEHYEKFEKMIQEHTDKFNKKMHEHSEHFKAKFAELLEQQKNAQFPGK

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-92aa

Sequence Info: Full Length

MW: 18.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May be involved in the regulation of the cytoskeleton through interaction with the subpellicular microtubules. May be involved in parasite mobility and attachment to the surface of the host cell. Behaves as a strong immunogen during infection.

Reference: "Mapping of the antigenic determinants of the T. cruzi kinetoplastid membrane protein-11. Identification of a linear epitope specifically recognized by human Chagasic sera." Thomas M.C., Longobardo M.V., Carmelo E., Maranon C., Planelles L., Patarroyo M.E., Alonso C., Lopez M.C. Clin. Exp. Immunol. 123:465-471(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May be involved in the regulation of the cytoskeleton through interaction with the subpellicular microtubules. May be involved in parasite mobility and attachment to the surface of the host cell. Behaves as a strong immunogen during infection.

Involvement in disease:

Subcellular Location: Cytoplasm, cytoskeleton

Protein Families: KMP-11 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9U6Z1

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A