Recombinant Triticum aestivum Granule-bound starch synthase 1, chloroplastic/amyloplastic (WAXY), partial | CSB-EP333285TQN

Recombinant Triticum aestivum Granule-bound starch synthase 1, chloroplastic/amyloplastic (WAXY), partial | CSB-EP333285TQN | Cusabio

Alternative Name(s): Granule-bound starch synthase I Short name: GBSS-I

Gene Names: WAXY

Research Areas: Others

Organism: Triticum aestivum (Wheat)

AA Sequence: LVFVGAEMAPWSKTGGLGDVLGGLPAAMAANGHRVMVISPRYDQYKDAWDTSVISEIKVVDRYERVRYFHCYKRGVDRVFVDHPCFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALEVPRILDLNNNPHFSGPYAMLCRAVPRRAGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTAKVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINWMKAGILQADKVLTVSPYYAEELISGEARGCELDNIMR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 79-349aa

Sequence Info: Partial

MW: 35.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Wheat granule-bound starch synthase I and II are encoded by separate genes that are expressed in different tissues." Vrinten P.L., Nakamura T. Plant Physiol. 122:255-264(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Plastid, chloroplast, Plastid, amyloplast

Protein Families: Glycosyltransferase 1 family, Bacterial/plant glycogen synthase subfamily

Tissue Specificity: Found in seeds and pollen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P27736

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A