Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C | CSB-EP326146TIF

(No reviews yet) Write a Review
SKU:
CSB-EP326146TIF
Availability:
13 - 23 Working Days
  • Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C | CSB-EP326146TIF | Cusabio

Alternative Name(s): Ribosome-inactivating protein karasurin-C; EC 3.2.2.22; rRNA N-glycosidase) [Cleaved into: Ribosome-inactivating protein karasurin-A]

Gene Names: N/A

Research Areas: Others

Organism: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

AA Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 22-270aa

Sequence Info: Full Length of Mature Protein

MW: 43.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.

Reference: Cloning and bacterial expression of a gene encoding ribosome-inactivating proteins, karasurin-A and karasurin-C, from Trichosanthes kirilowii var. japonica.Mizukami H., Iida K., Kondo T., Ogihara Y.Biol. Pharm. Bull. 20:711-713(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.

Involvement in disease:

Subcellular Location:

Protein Families: Ribosome-inactivating protein family, Type 1 RIP subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P24478

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose