Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin | CSB-EP357829TIFb0

(No reviews yet) Write a Review
SKU:
CSB-EP357829TIFb0
Availability:
3 - 7 Working Days
€352.00 - €878.00

Description

Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin | CSB-EP357829TIFb0 | Cusabio

Alternative Name(s): rRNA N-glycosidase (Alpha-TCS)

Gene Names: N/A

Research Areas: Others

Organism: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)

AA Sequence: DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 24-270aa

Sequence Info: Full Length of Mature Protein

MW: 30.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inactivates eukaryotic 60S ribosomal subunits.

Reference: "The C-terminal fragment of the ribosomal P protein complexed to trichosanthin reveals the interaction between the ribosome-inactivating protein and the ribosome." Too P.H., Ma M.K., Mak A.N., Wong Y.T., Tung C.K., Zhu G., Au S.W., Wong K.B., Shaw P.C. Nucleic Acids Res. 37:602-610(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inactivates eukaryotic 60S ribosomal subunits.

Involvement in disease:

Subcellular Location:

Protein Families: Ribosome-inactivating protein family, Type 1 RIP subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P09989

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose