Cusabio Virus & Bacteria Recombinants
Recombinant Toxocara canis 26 kDa secreted antigen (TES-26) | CSB-BP347478THA
- SKU:
- CSB-BP347478THA
- Availability:
- 28 - 38 Working Days
Description
Recombinant Toxocara canis 26 kDa secreted antigen (TES-26) | CSB-BP347478THA | Cusabio
Alternative Name(s): Toxocara excretory-secretory antigen 26 Short name: TES-26
Gene Names: TES-26
Research Areas: Others
Organism: Toxocara canis (Canine roundworm)
AA Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA
Source: Baculovirus
Tag Info: C-terminal 9xHis-tagged
Expression Region: 22-262aa
Sequence Info: Full Length of Mature Protein
MW: 27.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Binds phosphatidylethanolamine.
Reference: "An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins."Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995).
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Binds phosphatidylethanolamine.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: Phosphatidylethanolamine-binding protein family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P54190
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A