Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 | CSB-BP323347TON

(No reviews yet) Write a Review
SKU:
CSB-BP323347TON
Availability:
3 - 7 Working Days
$531.60 - $1,766.40

Description

Recombinant Tityus serrulatus Beta-mammal/insect toxin Ts1 | CSB-BP323347TON | Cusabio

Alternative Name(s): PT-Mice-Ins-beta NaTx6.1 (Tityustoxin VII) (Toxin II-11) (Toxin III-10) (Toxin T2-IV) (Toxin gamma) (TsTX-I)

Gene Names: N/A

Research Areas: Others

Organism: Tityus serrulatus(Brazilian scorpion)

AA Sequence: KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 21-81aa

Sequence Info: Full Length of Mature Protein

MW: 10.8

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. In addition, it stimulates the release of NO, IL-6 and TNF-alpha in J774.1 cells . This toxin is active against both mammals and insects.

Reference: "Molecular cloning and nucleotide sequence analysis of a cDNA encoding the main beta-neurotoxin from the venom of the South American scorpion Tityus serrulatus." Martin-Eauclaire M.-F., Ceard B., Ribeiro A.M., Diniz C.R., Rochat H., Bougis P.E. FEBS Lett. 302:220-222(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15226

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose