Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial | CSB-MP005386TOT

(No reviews yet) Write a Review
SKU:
CSB-MP005386TOT
Availability:
3 - 7 Working Days
  • Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£423.20 - £4,116.00

Description

Recombinant Tetronarce californica Acetylcholine receptor subunit alpha (CHRNA1), partial | CSB-MP005386TOT | Cusabio

Alternative Name(s):

Gene Names: CHRNA1

Research Areas: Neuroscience

Organism: Tetronarce californica (Pacific electric ray) (Torpedo californica)

AA Sequence: SEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRI

Source: Mammalian cell

Tag Info: N-terminal 10xHis-tagged

Expression Region: 25-234aa

Sequence Info: Partial

MW: 28.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Reference: "Proteolytic fragments of the nicotinic acetylcholine receptor identified by mass spectrometry: implications for receptor topography." Moore C.R., Yates J.R. III, Griffin P.R., Shabanowitz J., Martino P.A., Hunt D.F., Cafiso D.S. Biochemistry 28:9184-9191(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P02710

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose