Recombinant Synsepalum dulcificum Miraculin | CSB-YP320179RES

Recombinant Synsepalum dulcificum Miraculin | CSB-YP320179RES | Cusabio

Alternative Name(s): Miraculin; MIR

Gene Names: N/A

Research Areas: Others

Organism: Synsepalum dulcificum (Miracle fruit) (Richadella dulcifica)

AA Sequence: DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 30-220aa

Sequence Info: Full Length of Mature Protein

MW: 23.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.

Reference: "Structural study of asparagine-linked oligosaccharide moiety of taste-modifying protein, miraculin." Takahashi N., Hitotsuya H., Hanzawa H., Arata Y., Kurihara Y. J. Biol. Chem. 265:7793-7798(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Miraculin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes.

Involvement in disease:

Subcellular Location:

Protein Families: Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family

Tissue Specificity: Expressed in fruit pulp after pollination. Not expressed in seeds, stems or leaves.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13087

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A