Recombinant Streptomyces globisporus Lysozyme M1 (acm) | CSB-EP326536SOH

(No reviews yet) Write a Review
SKU:
CSB-EP326536SOH
Availability:
13 - 23 Working Days
  • Recombinant Streptomyces globisporus Lysozyme M1 (acm)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Streptomyces globisporus Lysozyme M1 (acm) | CSB-EP326536SOH | Cusabio

Alternative Name(s): 1,4-beta-N-acetylmuramidase M1

Gene Names: acm

Research Areas: Others

Organism: Streptomyces globisporus

AA Sequence: DTSGVQGIDVSHWQGSINWSSVKSAGMSFAYIKATEGTNYKDDRFSANYTNAYNAGIIRGAYHFARPNASSGTAQADYFASNGGGWSRDNRTLPGVLDIEHNPSGAMCYGLSTTQMRTWINDFHARYKARTTRDVVIYTTASWWNTCTGSWNGMAAKSPFWVAHWGVSAPTVPSGFPTWTFWQYSATGRVGGVSGDVDRNKFNGSAARLLALANNTA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 78-294aa

Sequence Info: Full Length of Mature Protein

MW: 30.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.

Reference: "A new lysozyme fold. Crystal structure of the muramidase from Streptomyces coelicolor at 1.65 A resolution." Rau A., Hogg T., Marquardt R., Hilgenfeld R. J. Biol. Chem. 276:31994-31999(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This enzyme has both lysozyme (acetylmuramidase) and diacetylmuramidase activities.

Involvement in disease:

Subcellular Location: Secreted, extracellular space

Protein Families: Glycosyl hydrolase 25 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25310

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose