Recombinant Streptomyces alboniger Puromycin N-acetyltransferase (pac) | CSB-EP319512SNI

Recombinant Streptomyces alboniger Puromycin N-acetyltransferase (pac) | CSB-EP319512SNI | Cusabio

Alternative Name(s): pac; Puromycin N-acetyltransferase; EC 2.3.-.-

Gene Names: pac

Research Areas: Others

Organism: Streptomyces alboniger

AA Sequence: MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-199aa

Sequence Info: Full Length

MW: 37.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Detoxification of puromycin.

Reference: "Molecular analysis of the pac gene encoding a puromycin N-acetyl transferase from Streptomyces alboniger."Lacalle R.A., Pulido D., Vara J., Zalacain M., Jimenez A.Gene 79:375-380(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Detoxification of puromycin.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P13249

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A