Recombinant Streptomyces achromogenes Modification methylase SacI (sacIM) | CSB-EP523234FNS

Recombinant Streptomyces achromogenes Modification methylase SacI (sacIM) | CSB-EP523234FNS | Cusabio

Alternative Name(s): Cytosine-specific methyltransferase SacI

Gene Names: sacIM

Research Areas: Others

Organism: Streptomyces achromogenes

AA Sequence: MNHELPVISLFSGAGGLDCAIESCAEPPLVQDGSGSPLRVAVATDYEQTALDTLSANFPHTKTLCGDIQTIPTAELLEAGGLKPGDPTLVIGGPPCTPFSKSGFWIEEKRNSADPNASLLDEYVRVVRESKPEAFILENVQGLTYKTHQAQFDRLIAGLKDAGYNPTFRVLLAAEYGVPQLRRRVFVVGRRDGKAFHFPETTHSGESERDRVIDHTKIPFTSLREALAGLPDVPEAGEVVEGTYAELAAEVPPGQNYLWHTDRYGGRNEFKWRSRYWTFLLKADPDRPSTTLQAQPGPWVGPFHWENVKNANGEERARRFRVAEMKRIMTFPDEFVFTGVKREVQRQIGNPVPVELGKVVVRALMEQLGYLDSRGTTIPSQAGHEQLELI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-390aa

Sequence Info: Full Length

MW: 59.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease.

Reference: Cloning and expression of the ApaLI, NspI, NspHI, SacI, ScaI, and SapI restriction-modification systems in Escherichia coli.Xu S.-Y., Xiao J.-P., Ettwiller L., Holden M., Aliotta J., Poh C.L., Dalton M., Robinson D.P., Petronzio T.R., Moran L., Ganatra M., Ware J., Slatko B., Benner J. IIMol. Gen. Genet. 260:226-231(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease.

Involvement in disease:

Subcellular Location:

Protein Families: Class I-like SAM-binding methyltransferase superfamily, C5-methyltransferase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O31073

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A