Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS) | CSB-BP669769SBAF

(No reviews yet) Write a Review
SKU:
CSB-BP669769SBAF
Availability:
3 - 7 Working Days
  • Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS)
  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP669769SBAF could indicate that this peptide derived from Baculovirus-expressed Streptococcus pyogenes serotype M28 (strain MGAS6180) acpS.
  • Based on the SEQUEST from database of Baculovirus host and target protein, the LC-MS/MS Analysis result of CSB-BP669769SBAF could indicate that this peptide derived from Baculovirus-expressed
£303.20 - £848.00

Description

Recombinant Streptococcus pyogenes serotype M28 Holo-[acyl-carrier-protein] synthase (acpS) | CSB-BP669769SBAF | Cusabio

Alternative Name(s): 4'-phosphopantetheinyl transferase AcpS (Holo-ACP synthase)

Gene Names: acpS

Research Areas: Others

Organism: Streptococcus pyogenes serotype M28 (strain MGAS6180)

AA Sequence: MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-118aa

Sequence Info: Full Length

MW: 17.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Reference: "Genome sequence of a serotype M28 strain of group A Streptococcus: potential new insights into puerperal sepsis and bacterial disease specificity." Green N.M., Zhang S., Porcella S.F., Nagiec M.J., Barbian K.D., Beres S.B., Lefebvre R.B., Musser J.M. J. Infect. Dis. 192:760-770(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: P-Pant transferase superfamily, AcpS family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q48RM7

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose