Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt) | CSB-YP001954SMT

(No reviews yet) Write a Review
SKU:
CSB-YP001954SMT
Availability:
3 - 7 Working Days
  • Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,618.40

Description

Recombinant Streptococcus pyogenes serotype M1 Adenine phosphoribosyltransferase (apt) | CSB-YP001954SMT | Cusabio

Alternative Name(s): apt; SPy_0927; M5005_Spy0728Adenine phosphoribosyltransferase; APRT; EC 2.4.2.7

Gene Names: apt

Research Areas: Others

Organism: Streptococcus pyogenes serotype M1

AA Sequence: MDLTNYIASIKDYPKAGITFRDISPLMADGKAYSYAIREIAQYACDKDIDMVVGPEARGFIIGCPVAVELGIGFAPVRKPGKLPRDVVSADYEKEYGLDTLTMHADAIKPGQRVLIVDDLLATGGTVKATIEMIEKLGGIVAGCAFLIELEGLNGRHAIRNYDYKVLMQFPG

Source: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-172aa

Sequence Info: Full Length

MW: 22.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Reference: "Evolutionary origin and emergence of a highly successful clone of serotype M1 group A Streptococcus involved multiple horizontal gene transfer events." Sumby P., Porcella S.F., Madrigal A.G., Barbian K.D., Virtaneva K., Ricklefs S.M., Sturdevant D.E., Graham M.R., Vuopio-Varkila J., Hoe N.P., Musser J.M. J. Infect. Dis. 192:771-782(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Purine/pyrimidine phosphoribosyltransferase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P63546

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose