Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB) | CSB-EP357862SKYa2

(No reviews yet) Write a Review
SKU:
CSB-EP357862SKYa2
Availability:
13 - 23 Working Days
  • Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Staphylococcus aureus Gamma-hemolysin component B (hlgB) | CSB-EP357862SKYa2 | Cusabio

Alternative Name(s): H-gamma-1 H-gamma-I

Gene Names: hlgB

Research Areas: Microbiology

Organism: Staphylococcus aureus (strain N315)

AA Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNVVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTTLSRNTNYKNVGWGVEAHKIMNNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDGAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 26-325aa

Sequence Info: Full Length of Mature Protein

MW: 50.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity

Reference: "Shotgun proteomic analysis of total and membrane protein extracts of S. aureus strain N315."Vaezzadeh A.R., Deshusses J., Lescuyer P., Hochstrasser D.F.Submitted (OCT-2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Toxin that seems to act by forming pores in the membrane of the cell. Has a hemolytic and a leucotoxic activity (By similarity).

Involvement in disease:

Subcellular Location:

Protein Families: Aerolysin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0A075

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose