Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2) | CSB-EP339410FKZe1

(No reviews yet) Write a Review
SKU:
CSB-EP339410FKZe1
Availability:
3 - 7 Working Days
  • Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£368.00 - £1,448.00

Description

Recombinant Staphylococcus aureus Enterotoxin type C-2 (entC2) | CSB-EP339410FKZe1 | Cusabio

Alternative Name(s): SEC2

Gene Names: entC2

Research Areas: Others

Organism: Staphylococcus aureus

AA Sequence: ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Source: E.coli

Tag Info: Tag-Free

Expression Region: 28-266aa

Sequence Info: Full Length of Mature Protein

MW: 27.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Reference: "Conservation of the biologically active portions of staphylococcal enterotoxins C1 and C2." Bohach G.A., Schlievert P.M. Infect. Immun. 57:2249-2252(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Staphylococcal/streptococcal toxin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P34071

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose