Recombinant Spiroplasma citri Spiralin (spi) | CSB-EP322510FKO

Recombinant Spiroplasma citri Spiralin (spi) | CSB-EP322510FKO | Cusabio

Alternative Name(s): spi; Spiralin

Gene Names: spi

Research Areas: Others

Organism: Spiroplasma citri

AA Sequence: CNKTESNNLSIVKTIAVPATVATANPKQVTNAEIKTALEANVLKAVQGVVKTATAADFQFDVYQDNKGTSLTTINLEEGNVEVYVQITPAKDKTVVIGETGYIKVTLPKIKVDISGVVIDQQIVEIKAADPKQVTKDELNAVNTYATLASAVLEAIKNKAPNAGASDFEITNNCDAGDYSAQKDVKVTVKAKDESPNISGEFKVNAKVKATLAPPKAG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-241aa

Sequence Info: Full Length of Mature Protein

MW: 39 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Major membrane protein of spiroplasma.

Reference: "Organization and nucleotide sequences of the Spiroplasma citri genes for ribosomal protein S2, elongation factor Ts, spiralin, phosphofructokinase, pyruvate kinase, and an unidentified protein."Chevalier C., Saillard C., Bove J.M.J. Bacteriol. 172:2693-2703(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Major membrane protein of spiroplasma.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor

Protein Families: Spiralin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19215

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A