Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial | CSB-EP365424FKI

Recombinant Spinacia oleracea Plastocyanin, chloroplastic (PETE), partial | CSB-EP365424FKI | Cusabio

Alternative Name(s): PETE; Plastocyanin; chloroplastic

Gene Names: PETE

Research Areas: Others

Organism: Spinacia oleracea (Spinach)

AA Sequence: VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 70-168aa

Sequence Info: Partial

MW: 26.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.

Reference: "Plastocyanin is encoded by an uninterrupted nuclear gene in spinach." Rother C., Jansen T., Tyagi A., Tittgen J., Herrmann R.G. Curr. Genet. 11:171-176(1986)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I.

Involvement in disease:

Subcellular Location: Plastid, chloroplast thylakoid membrane, Peripheral membrane protein, Lumenal side

Protein Families: Plastocyanin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00289

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A