Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin | CSB-YP307648LKN

Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin | CSB-YP307648LKN | Cusabio

Alternative Name(s): Ribosome-inactivating protein lychnin; EC 3.2.2.22

Gene Names: N/A

Research Areas: Others

Organism: Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica)

AA Sequence: RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-234aa

Sequence Info: Full Length

MW: 28.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC50 of 0.17 nM.

Reference: "Sequence determination of lychnin, a type 1 ribosome-inactivating protein from Lychnis chalcedonica seeds."Chambery A., de Donato A., Bolognesi A., Polito L., Stirpe F., Parente A.Biol. Chem. 387:1261-1266(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticulocyte lysate system with an IC(50) of 0.17 nM.

Involvement in disease:

Subcellular Location:

Protein Families: Ribosome-inactivating protein family, Type 1 RIP subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P85101

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A