Recombinant Shigella flexneri Glutaredoxin-4 (grxD) | CSB-EP364758SZB

(No reviews yet) Write a Review
SKU:
CSB-EP364758SZB
Availability:
3 - 7 Working Days
  • Recombinant Shigella flexneri Glutaredoxin-4 (grxD)
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364758SZB could indicate that this peptide derived from E.coli-expressed Shigella flexneri grxD.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP364758SZB could indicate that this peptide derived from E.coli-expressed
$422.40 - $2,042.40

Description

Recombinant Shigella flexneri Glutaredoxin-4 (grxD) | CSB-EP364758SZB | Cusabio

Alternative Name(s): Monothiol glutaredoxin (ydhD) (Grx4)

Gene Names: grxD

Research Areas: Cell Biology

Organism: Shigella flexneri

AA Sequence: MSTTIEKIQRQIAENPILLYMKGSPKLPSCGFSAQAVQALAACGERFAYVDILQNPDIRAELPKYANWPTFPQLWVDGELVGGCDIVIEMYQRGELQQLIKETAAKYKSEEPDAE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-115aa

Sequence Info: Full Length

MW: 28.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.

Reference: "Complete genome sequence and comparative genomics of Shigella flexneri serotype 2a strain 2457T." Wei J., Goldberg M.B., Burland V., Venkatesan M.M., Deng W., Fournier G., Mayhew G.F., Plunkett G. III, Rose D.J., Darling A., Mau B., Perna N.T., Payne S.M., Runyen-Janecky L.J., Zhou S., Schwartz D.C., Blattner F.R. Infect. Immun. 71:2775-2786(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Glutaredoxin family, Monothiol subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0AC72

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose