Cusabio Ovis aries Recombinants
Recombinant Sheep Serum amyloid A protein (SAA1) | CSB-EP020656SH
- SKU:
 - CSB-EP020656SH
 - Availability:
 - 3 - 7 Working Days
 
Description
Recombinant Sheep Serum amyloid A protein (SAA1) | CSB-EP020656SH | Cusabio
Alternative Name(s): SAA
Gene Names: SAA1
Research Areas: Cardiovascular
Organism: Ovis aries (Sheep)
AA Sequence: QWLSFLGEAYEGAKDMWRAYSDMREANFKGADKYFHARGNYDAAQRGPGGVWAAEVISNGREALQGITDPLFKGMTRDQVREDTKADQFANEWGRSGKDPNHFRPPGLPDKY
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-112aa
Sequence Info: Full Length
MW: 18.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Major acute phase reactant. Apolipoprotein of the HDL complex.
Reference: "The primary structure of serum amyloid A protein in the sheep: comparison with serum amyloid A in other species." Syversen P.V., Juul J., Marhaug G., Husby G., Sletten K. Scand. J. Immunol. 39:88-94(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P42819
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A