Recombinant Sheep Interleukin-10 (IL10) | CSB-YP640904SH

Recombinant Sheep Interleukin-10 (IL10) | CSB-YP640904SH | Cusabio

Alternative Name(s): Cytokine synthesis inhibitory factor ;CSIF

Gene Names: IL10

Research Areas: Others

Organism: Ovis aries (Sheep)

AA Sequence: SRDASTLSDSSCTHFPASLPHMLRDVRAAFGKVKTFFQMKDQLNSMLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEQVKRVFNMLQERGVYKAMSEFDIFINYIESYMTTKM

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 20-177aa

Sequence Info: Full Length of Mature Protein

MW: 20.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Reference: Sequence of the sheep interleukin-10-encoding cDNA.Dutia B.M., Hunt P., Sargan D.R., Dalziel R.G., Hopkins J.Gene 149:393-394(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-10 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q29408

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A