Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial | CSB-MP348663HQEc7

(No reviews yet) Write a Review
SKU:
CSB-MP348663HQEc7
Availability:
3 - 7 Working Days
£158.40 - £2,503.20

Description

Recombinant Severe acute respiratory syndrome coronavirus Spike glycoprotein (S), partial | CSB-MP348663HQEc7 | Cusabio

Target Name: S

Uniprot No: P59594

Species: Severe acute respiratory syndrome coronavirus (SARS-CoV)

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 306-527aa

Sequence Description: Partial

Target Protein Sequence: RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF

Mol. Weight: 27.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm sterile fiiltered 20mM Tris-HCl,400mM NaCl,6% Trehalose,pH 7.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

View AllClose

0 Reviews

View AllClose