Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9) | CSB-MP3388GND

(No reviews yet) Write a Review
SKU:
CSB-MP3388GND
Availability:
3 - 7 Working Days
  • Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€198.00 - €2,263.00

Description

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 9 (nsp9) | CSB-MP3388GND | Cusabio

Target Name: Nsp9

Uniprot No: P0DTD1/YP_009742616.1

Species: Human Novel Coronavirus (SARS-CoV-2/ 2019-nCoV)

Source: Mammalian cell

Tag Info: C-terminal hFc-Flag-tagged

Expression Region: 1-113aa

Sequence Description: Full length

Target Protein Sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELE PPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ

Mol. Weight: 44.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

View AllClose

0 Reviews

View AllClose