Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 3 (nsp3), partial | CSB-EP3398GND

Recombinant Severe acute respiratory syndrome coronavirus 2 Non-structural protein 3 (nsp3), partial | CSB-EP3398GND | Cusabio

Target Name: NSP3

Uniprot No: P0DTD1/YP_009725299.1

Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 746-1060aa

Sequence Description: Partial (Partial of YP_009725299.1 nsp3)

Target Protein Sequence: EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK

Mol. Weight: 41.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.