Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M), partial | CSB-EP3402GND

Recombinant Severe acute respiratory syndrome coronavirus 2 Envelope small membrane protein & Membrane protein (E & M), partial | CSB-EP3402GND | Cusabio

Target Name: E & M

Uniprot No: P0DTC4 & P0DTC5

Species: Severe acute respiratory syndrome coronavirus 2

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-42aa

Sequence Description: Partial

Target Protein Sequence: MYSFVSEETGTLIVNSADSNGTITVEELKKLLEQRINWITGG

Mol. Weight: 17.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test.

Biological Activity: N/A

Form: Lyophilized powder

Buffer: Lyophilized from 20 mM Tris-HCl,0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.