Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein, partial | CSB-EP328381SXQ1

Recombinant Schistosoma mansoni Antigenic integral membrane glycoprotein, partial | CSB-EP328381SXQ1 | Cusabio

Alternative Name(s): Antigen Sm25

Gene Names: N/A

Research Areas: others

Organism: Schistosoma mansoni (Blood fluke)

AA Sequence: VNSEENSNSIITDEDYDHYNSSLDSSNNVKHSQEAFHRNSDPDGFPEYEFLNETSIEIKEELGQELHQLQLILDELSRRIRATPNSANKYMK

Source: E.coli

Tag Info: N-terminal 6xHis-Trx-tagged

Expression Region: 69-160aa

Sequence Info: Partial

MW: 28.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Major antigen in the surface tegument.

Reference: "Structure of Sm25, an antigenic integral membrane glycoprotein of adult Schistosoma mansoni." Omer Ali P., Jeffs S.A., Meadows H.M., Hollyer T., Owen C., Hackett F., Smithers S.R., Simpson A.J.G. Mol. Biochem. Parasitol. 45:215-222(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P23126

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A