Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme | CSB-YP357414SXP

Recombinant Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme | CSB-YP357414SXP | Cusabio

Alternative Name(s): Sj26 antigen (SjGST) (GST 26)

Gene Names: N/A

Research Areas: Others

Organism: Schistosoma japonicum (Blood fluke)

AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPEFPGRLERPHRD

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-218aa

Sequence Info: Full Length of Mature Protein

MW: 30.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.GST isoenzymes appear to play a central role in the parasite detoxification system. Other functions are also suspected including a role in increasing the solubility of haematin in the parasite gut.

Reference: "Insights into dynein motor domain function from a 3.3-A crystal structure." Schmidt H., Gleave E.S., Carter A.P. Nat. Struct. Mol. Biol. 19:492-497(2012)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.; FUNCTION

Involvement in disease:

Subcellular Location:

Protein Families: GST superfamily, Mu family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08515

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A