Cusabio Salmonella typhimurium Recombinants
Recombinant Salmonella typhimurium Protein PrgJ (PrgJ) | CSB-EP331347SXB
- SKU:
- CSB-EP331347SXB
- Availability:
- 3 - 7 Working Days
Description
Recombinant Salmonella typhimurium Protein PrgJ (PrgJ) | CSB-EP331347SXB | Cusabio
Alternative Name(s): prgJ; STM2872Protein PrgJ
Gene Names: prgJ
Research Areas: Others
Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
AA Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-101aa
Sequence Info: Full Length
MW: 15.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Required for invasion of epithelial cells.
Reference: "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2."McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. Wilson R.K.Nature 413:852-856(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Required for invasion of epithelial cells.
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P41785
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A