null

Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3 (SMT3) | CSB-EP615489SVG

(No reviews yet) Write a Review
SKU:
CSB-EP615489SVG
Availability:
3 - 7 Working Days
  • Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3 (SMT3)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00
Frequently bought together:

Description

Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3 (SMT3) | CSB-EP615489SVG | Cusabio

Alternative Name(s): DmSUMO 1; Small Ubiquitin-like modifier; SMT3; SMT3_YEAST; Ubiquitin like protein of the SUMO family; Ubiquitin like protein SMT3; Ubiquitin-like protein SMT3

Gene Names: SMT3

Research Areas: Others

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 2-98aa

Sequence Info: Full Length of Mature Protein

MW: 27.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Not known; suppressor of MIF2 mutations.

Reference: Ulp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regulatory element essential for cell growth in yeast.Mossessova E., Lima C.D.Mol. Cell 5:865-876(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Not known; suppressor of MIF2 mutations.

Involvement in disease:

Subcellular Location:

Protein Families: Ubiquitin family, SUMO subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q12306

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose