Cusabio Saccharomyces cerevisiae Recombinants
Recombinant Saccharomyces cerevisiae ProlifeRating cell nuclear antigen (POL30) | CSB-YP017621SVG
- SKU:
- CSB-YP017621SVG
- Availability:
- 25 - 35 Working Days
Description
Recombinant Saccharomyces cerevisiae ProlifeRating cell nuclear antigen (POL30) | CSB-YP017621SVG | Cusabio
Alternative Name(s): Short name: PCNA
Gene Names: POL30
Research Areas: Microbiology
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence: MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-258aa
Sequence Info: Full Length
MW: 30.9 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.
Reference: "Interaction with PCNA is essential for yeast DNA polymerase eta function."Haracska L., Kondratick C.M., Unk I., Prakash S., Prakash L. Mol. Cell 8:407-415(2001)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.
Involvement in disease:
Subcellular Location: Nucleus
Protein Families: PCNA family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P15873
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A