Recombinant Saccharomyces cerevisiae Proliferating cell nuclear antigen (POL30) | CSB-EP017621SVG

(No reviews yet) Write a Review
SKU:
CSB-EP017621SVG
Availability:
13 - 23 Working Days
  • Recombinant Saccharomyces cerevisiae Proliferating cell nuclear antigen (POL30)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Saccharomyces cerevisiae Proliferating cell nuclear antigen (POL30) | CSB-EP017621SVG | Cusabio

Alternative Name(s): PCNA

Gene Names: POL30

Research Areas: Others

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-258aa

Sequence Info: Full Length

MW: 44.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.

Reference: "Molecular cloning, structure and expression of the yeast proliferating cell nuclear antigen gene."Bauer G.A., Burgess P.M.J.Nucleic Acids Res. 18:261-265(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. Involved in DNA repair.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: PCNA family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P15873

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose