null

Recombinant Saccharomyces cerevisiae Phosphoglycerate mutase 1 (GPM1) | CSB-YP017834SVG

(No reviews yet) Write a Review
SKU:
CSB-YP017834SVG
Availability:
25 - 35 Working Days
  • Recombinant Saccharomyces cerevisiae Phosphoglycerate mutase 1 (GPM1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€383.00 - €2,023.00
Frequently bought together:

Description

Recombinant Saccharomyces cerevisiae Phosphoglycerate mutase 1 (GPM1) | CSB-YP017834SVG | Cusabio

Alternative Name(s): BPG-dependent PGAM 1 MPGM 1 Phosphoglyceromutase 1

Gene Names: GPM1

Research Areas: others

Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

AA Sequence: PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAAVANQGKK

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-247aa

Sequence Info: Full Length of Mature Protein

MW: 29.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also Catalyzes the reaction of EC 5.4.2.4 (synthase), but with a reduced activity. Miscellaneous Present with 172000 molecules/cell in log phase SD medium.

Reference: "Transcriptional control of yeast phosphoglycerate mutase-encoding gene." Rodicio R., Heinisch J.J., Hollenberg C.P. Gene 125:125-133(1993)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P00950

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose