Cusabio Saccharomyces cerevisiae Recombinants
Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1) | CSB-EP360492SVG
- SKU:
- CSB-EP360492SVG
- Availability:
- 13 - 23 Working Days
Description
Recombinant Saccharomyces cerevisiae GTP-binding protein YPT1 (YPT1) | CSB-EP360492SVG | Cusabio
Alternative Name(s): Protein YP2 Rab GTPase YPT1 Transport GTPase YPT1
Gene Names: YPT1
Research Areas: Others
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence: MNSEYDYLFKLLLIGNSGVGKSCLLLRFSDDTYTNDYISTIGVDFKIKTVELDGKTVKLQIWDTAGQERFRTITSSYYRGSHGIIIVYDVTDQESFNGVKMWLQEIDRYATSTVLKLLVGNKCDLKDKRVVEYDVAKEFADANKMPFLETSALDSTNVEDAFLTMARQIKESMSQQNLNETTQKKEDKGNVNLKGQSLTNTGGGCC
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-206aa
Sequence Info: Full Length
MW: 39.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.
Reference: "A yeast gene encoding a protein homologous to the human c-has/bas proto-oncogene product."Gallwitz D., Donath C., Sander C.Nature 306:704-707(1983)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. YPT1 regulates the trafficking of secretory vesicles from the endoplasmic reticulum (ER) to the Golgi. Vesicular transport depends on shuttling of YPT1 between membrane and cytosol by GDI1, probably by recycling it to its membrane of origin after a vesicle fusion event. Plays a role in the initial events of the autophagic vacuole development which take place at specialized regions of the endoplasmic reticulum. Also involved in the recycling of membrane proteins.
Involvement in disease:
Subcellular Location: Endoplasmic reticulum membrane, Peripheral membrane protein, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasm, Preautophagosomal structure membrane, Lipid-anchor, Cytoplasmic side
Protein Families: Small GTPase superfamily, Rab family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P01123
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A