Cusabio Saccharomyces cerevisiae Recombinants
Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1 (DOG1) | CSB-YP336491SVG
- SKU:
- CSB-YP336491SVG
- Availability:
- 3 - 7 Working Days
Description
Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1 (DOG1) | CSB-YP336491SVG | Cusabio
Alternative Name(s): DOG1; YHR044C2-deoxyglucose-6-phosphate phosphatase 1; 2-DOG-6-P 1; 2-deoxyglucose-6-phosphatase 1; EC 3.1.3.68
Gene Names: DOG1
Research Areas: Others
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence: MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-246aa
Sequence Info: Full Length
MW: 29.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Active on 2-DOG-6P, also very active on fructose-1P.
Reference: "Molecular characterization of a gene that confers 2-deoxyglucose resistance in yeast."Sanz P., Randez-Gil F., Prieto J.A.Yeast 10:1195-1202(1994)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Active on 2-DOG-6P, also very active on fructose-1P.
Involvement in disease:
Subcellular Location:
Protein Families: HAD-like hydrolase superfamily, DOG/GPP family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P38774
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A