Recombinant Rhizobium meliloti Probable sulfoacetaldehyde acetyltransferase (xsc), partial | CSB-EP842343RKU

(No reviews yet) Write a Review
SKU:
CSB-EP842343RKU
Availability:
13 - 23 Working Days
  • Recombinant Rhizobium meliloti Probable sulfoacetaldehyde acetyltransferase (xsc), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Rhizobium meliloti Probable sulfoacetaldehyde acetyltransferase (xsc), partial | CSB-EP842343RKU | Cusabio

Alternative Name(s): /

Gene Names: xsc

Research Areas: Others

Organism: Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)

AA Sequence: MKMTTEEAFVKVLQMHGIEHAFGIIGSAMMPVSDLFPKAGIRFWDCAHETNAGMMADGFSRATGTMSMAIGQNGPGVTGFITAMKTAYWNHTPLLMVTPQAANKTIGQGGFQEVDQMAMFEEMVCYQEEVRDPSRIPEVLNRVIEKAWRGCAPAQINIPRDFWTQVIDVDLPRIVRFERPAGGPAAIAQAARLLSEAKFPVILNGAGVVIGNAIQESMALAEKLDAPVCCGYQHNDAFPGSHRLSVGPLGYNGSKAAMELISKADVVLALGTRLNPFSTLPGYGIDYWPKDAAIIQVDINADRIGLTKKVTVGICGDAKQVAQQILQQLAPAAGDASREER

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-341aa

Sequence Info: Partial

MW: 44.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "The complete sequence of the 1,683-kb pSymB megaplasmid from the N2-fixing endosymbiont Sinorhizobium meliloti." Finan T.M., Weidner S., Wong K., Buhrmester J., Chain P., Vorhoelter F.J., Hernandez-Lucas I., Becker A., Cowie A., Gouzy J., Golding B., Puehler A. Proc. Natl. Acad. Sci. U.S.A. 98:9889-9894(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q92UW6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose