Recombinant Rattus norvegicus Acetyl-CoA carboxylase 1 (Acaca), partial | CSB-YP001119RA

(No reviews yet) Write a Review
SKU:
CSB-YP001119RA
Availability:
25 - 35 Working Days
  • Recombinant Rattus norvegicus Acetyl-CoA carboxylase 1 (Acaca), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$406.80 - $1,614.00

Description

Recombinant Rattus norvegicus Acetyl-CoA carboxylase 1 (Acaca), partial | CSB-YP001119RA | Cusabio

Alternative Name(s): ACC-alpha Including the following 1 domains: Biotin carboxylase (EC:6.3.4.14)

Gene Names: Acaca

Research Areas: Cancer

Organism: Rattus norvegicus (Rat)

AA Sequence: VIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 116-617aa

Sequence Info: Partial

MW: 57.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.

Reference: "Pharmacological biotin supplementation maintains biotin status and function in rats administered dietary carbamazepine."Rathman S.C., Gregory J.F., McMahon R.J.J. Nutr. 133:2857-2862(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P11497

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose