Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial | CSB-EP644804RA

(No reviews yet) Write a Review
SKU:
CSB-EP644804RA
Availability:
13 - 23 Working Days
  • Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$357.60 - $2,042.40

Description

Recombinant Rat Zinc transporter ZIP13 (Slc39a13), partial | CSB-EP644804RA | Cusabio

Alternative Name(s): Solute carrier family 39 member 13Zrt- and Irt-like protein 13 ;ZIP-13

Gene Names: Slc39a13

Research Areas: Others

Organism: Rattus norvegicus (Rat)

AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA

Source: E.coli

Tag Info: N-terminal 6xHis-GST-tagged

Expression Region: 130-233aa

Sequence Info: Partial

MW: 41.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Acts as a zinc-influx transporter.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Acts as a zinc-influx transporter.

Involvement in disease:

Subcellular Location: Golgi apparatus membrane, Multi-pass membrane protein

Protein Families: ZIP transporter (TC 2.A.5) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q2M1K6

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose